Urbanstreetculture.co.za valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Home 1 - Urban Street Culture
Description N/A
Keywords N/A
Server Information
WebSite urbanstreetculture favicon www.urbanstreetculture.co.za
Host IP 164.160.91.40
Location Johannesburg, Gauteng, South Africa
Related Websites
Site Rank
More to Explore
vacuumville.ca
vavada.press
watchintenselyspeedythefile.vip
wealthep.com
wearmultiplynever.top
wvtg.com
3nifwancontact.club
adsstar.in
annamurphy.ch
appdataroom.com
perfect-dating.com
perfectionhangover.com
Urbanstreetculture.co.za Valuation
US$60,828
Last updated: Aug 7, 2021

Urbanstreetculture.co.za has global traffic rank of 1,684,417. Urbanstreetculture.co.za has an estimated worth of US$ 60,828, based on its estimated Ads revenue. Urbanstreetculture.co.za receives approximately 1,851 unique visitors each day. Its web server is located in Johannesburg, Gauteng, South Africa, with IP address 164.160.91.40. According to SiteAdvisor, urbanstreetculture.co.za is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$60,828
Daily Ads Revenue US$33
Monthly Ads Revenue US$999
Yearly Ads Revenue US$12,165
Daily Unique Visitors 1,851
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 1,684,417
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
urbanstreetculture.co.za A 14399 IP: 164.160.91.40
urbanstreetculture.co.za MX 14399 Priority: 0
Target: urbanstreetculture.co.za.
urbanstreetculture.co.za NS 21599 Target: ns5.za-dns.com.
urbanstreetculture.co.za NS 21599 Target: ns3.za-dns.com.
urbanstreetculture.co.za TXT 14399 TXT: google-site-verification=NLY0rX_odgIcj7dhnnEU2ogVa3X6wvLEvfGYe3mOFC0
urbanstreetculture.co.za TXT 14399 TXT: v=spf1 +a +mx +ip4:164.160.91.40 include:spf.zamailgate.com ~all
urbanstreetculture.co.za SOA 21599 MNAME: ns3.za-dns.com.
RNAME: servers.za-dns.com.
Serial: 2021080601
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 301 Moved Permanently
Connection: Keep-Alive
Content-Type: text/html
Content-Length: 707
Date: Sat, 07 Aug 2021 11:13:03 GMT
Server: LiteSpeed
Location: https://urbanstreetculture.co.za/

HTTP/2 200 
x-powered-by: PHP/5.6.40
content-type: text/html; charset=UTF-8
link: <https://urbanstreetculture.co.za/wp-json/>; rel="https://api.w.org/"
link: <https://urbanstreetculture.co.za/wp-json/wp/v2/pages/3381>; rel="alternate"; type="application/json"
link: <https://urbanstreetculture.co.za/>; rel=shortlink
date: Sat, 07 Aug 2021 11:13:06 GMT
server: LiteSpeed
alt-svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000

Urbanstreetculture.co.za Whois Information
Domain Name: urbanstreetculture.co.za
Registry Domain ID: DOM_2QX7S-CO.ZA
Registrar WHOIS Server:
Registrar URL: https://elitehost.co.za
Updated Date: 2021-05-26T12:44:02Z
Creation Date: 2015-05-25T10:01:09Z
Registry Expiry Date: 2022-05-25T10:01:09Z
Registrar Registration Expiration Date: 2022-05-25T10:01:09Z
Registrar: ZA-DNS
Registrar Abuse Contact Email: domainabuse@za-dns.com
Registrar Abuse Contact Phone: +27.120044678
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: REDACTED
Registrant Name: REDACTED
Registrant Organization: UrbanStreetCulture
Registrant Street: REDACTED
Registrant City: REDACTED
Registrant State/Province: Soweto
Registrant Postal Code: REDACTED
Registrant Country: ZA
Registrant Phone: REDACTED
Registrant Phone Ext: REDACTED
Registrant Fax: REDACTED
Registrant Fax Ext: REDACTED
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Registry Admin ID: REDACTED
Admin Name: REDACTED
Admin Organization: REDACTED
Admin Street: REDACTED
Admin City: REDACTED
Admin State/Province: REDACTED
Admin Postal Code: REDACTED
Admin Country: REDACTED
Admin Phone: REDACTED
Admin Phone Ext: REDACTED
Admin Fax: REDACTED
Admin Fax Ext: REDACTED
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Registry Tech ID: REDACTED
Tech Name: REDACTED
Tech Organization: REDACTED
Tech Street: REDACTED
Tech City: REDACTED
Tech State/Province: REDACTED
Tech Postal Code: REDACTED
Tech Country: REDACTED
Tech Phone: REDACTED
Tech Phone Ext: REDACTED
Tech Fax: REDACTED
Tech Fax Ext: REDACTED
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Registry Billing ID: REDACTED
Billing Name: REDACTED
Billing Organization: REDACTED
Billing Street: REDACTED
Billing City: REDACTED
Billing State/Province: REDACTED
Billing Postal Code: REDACTED
Billing Country: REDACTED
Billing Phone: REDACTED
Billing Phone Ext: REDACTED
Billing Fax: REDACTED
Billing Fax Ext: REDACTED
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin or Tech contacts of the domain name.
Name Server: ns3.za-dns.com
Name Server: ns5.za-dns.com
DNSSEC: unsigned
ZACR Complaint/s Procedure and Form: https://registry.net.za/content.php?gen=1&contentid=226